PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 733aa    MW: 81096.3 Da    PI: 6.3793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-151766148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++   g+  +Wk+ ++  g+ R++k+c++rw +yl
      Lus10003001 17 KGPWTAEEDSKLVDYIANKKGRhaNWKLLPKLAGLDRCGKSCRLRWTNYL 66
                     79**********************************************97 PP

2Myb_DNA-binding48.91.6e-1572116147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +  eE+ l +d++k lG++ W++Ia +++ gRt++++k++++++
      Lus10003001  72 RGGFDDEEERLVIDLHKTLGNK-WSKIATHLP-GRTDNEIKNYYNTH 116
                      677899****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9061266IPR017930Myb domain
SuperFamilySSF466891.72E-2415113IPR009057Homeodomain-like
SMARTSM007171.5E-91668IPR001005SANT/Myb domain
PfamPF002491.5E-121766IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-191873IPR009057Homeodomain-like
CDDcd001671.01E-71966No hitNo description
PROSITE profilePS5129424.08667121IPR017930Myb domain
SMARTSM007171.6E-1571119IPR001005SANT/Myb domain
PfamPF002491.6E-1372116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2474121IPR009057Homeodomain-like
CDDcd001671.60E-1175117No hitNo description
Gene3DG3DSA:2.160.20.101.8E-111369731IPR012334Pectin lyase fold
SuperFamilySSF511267.33E-107369732IPR011050Pectin lyase fold/virulence factor
PfamPF002952.3E-94397721IPR000743Glycoside hydrolase, family 28
SMARTSM00710510517543IPR006626Parallel beta-helix repeat
SMARTSM007101200544565IPR006626Parallel beta-helix repeat
PROSITE patternPS005020574587IPR000743Glycoside hydrolase, family 28
SMARTSM007104.3597618IPR006626Parallel beta-helix repeat
SMARTSM007103600627648IPR006626Parallel beta-helix repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0003677Molecular FunctionDNA binding
GO:0004650Molecular Functionpolygalacturonase activity
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MVRPPCCGEE DKMMVKKGPW TAEEDSKLVD YIANKKGRHA NWKLLPKLAG LDRCGKSCRL  60
RWTNYLRPGI KRGGFDDEEE RLVIDLHKTL GNKWSKIATH LPGRTDNEIK NYYNTHIRRK  120
LLRMGIDPQT HKPRTDHLHQ QQDIANQIVN FSQLIGAASQ LSNMMNIDSP SSTLNILENL  180
LVAASSTMQQ QIVTPFVLQQ LLLNNNQTIS HSLPLLLRGQ DSAPTGTLSL QDPLLLLARV  240
LNPVENLATT DYHKPVYIDD DKDKSTSENV VKNLIVKKEP MMPELVSWEA SPETSSSSLV  300
HNNHQENDHC SKFPDQTPTL FDSPVASIDI DNQLEAWERL LMMDDDFTGG EGFFSSTWTD  360
GAQDNVLTLF DINKYGAVCD GKTDSVDAFT KAFTAACESP TPACVVVPPG NYRLGIMTLK  420
GPCKSPITFQ VDGVLLAPPE IEGDSWVTFN YMEHFTLTGK GTFDGIGRDA WTKNDCHKNK  480
KCKLLPFNLR FNFIKQARIE GVTSKDSKSF NVNVLGCENI TFSNFRVLAP DESPNTDGIH  540
MGRSIGVNIV DSIFETGDDC ISVGDGIEQL RIENVKCGPG HGISIGSLGG SPEEKPVVGV  600
FVKNCTLTNT TNGVRIKTKP TSFPGIVTDI HFEDIVMNNV WNPIIIDQVY CPHNLCANKL  660
PSKVALSKVF FKNIRGTSRD EHVITMNCSP EVPCADVEVQ DVDLTYSGPR GPAQAVCTNV  720
KPRIIGKMNP TC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28171217108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006387858.11e-141hypothetical protein POPTR_0519s00220g
TrEMBLU7DXF41e-141U7DXF4_POPTR; Uncharacterized protein
STRINGPOPTR_0519s00220.11e-141(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-64myb domain protein 9